PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA03G0372200.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB_related
Protein Properties Length: 1587aa    MW: 176078 Da    PI: 5.9762
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA03G0372200.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding24.66e-0814801521144
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
    Myb_DNA-binding    1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44  
                         r +W++ E ++++++ +q+G++ ++ I + ++  ++++q++ ++
  ORGLA03G0372200.1 1480 RAKWSKSETDKFYEGLQQFGSD-FAMIQHLFP-DKSRNQVRQKF 1521
                         569*******************.*********.********998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS513757.454939IPR002885Pentatricopeptide repeat
PfamPF015350.0181439IPR002885Pentatricopeptide repeat
PROSITE profilePS513758.6274074IPR002885Pentatricopeptide repeat
Gene3DG3DSA:1.25.40.101.7E-84071IPR011990Tetratricopeptide-like helical domain
PfamPF015350.0354269IPR002885Pentatricopeptide repeat
PROSITE profilePS513756.68675109IPR002885Pentatricopeptide repeat
Gene3DG3DSA:1.25.40.101.7E-8108158IPR011990Tetratricopeptide-like helical domain
PROSITE profilePS513757.881110140IPR002885Pentatricopeptide repeat
PfamPF015350.0071115140IPR002885Pentatricopeptide repeat
PROSITE profilePS5137510.523141175IPR002885Pentatricopeptide repeat
PfamPF015350.025144172IPR002885Pentatricopeptide repeat
PROSITE profilePS513755.985176211IPR002885Pentatricopeptide repeat
PROSITE profilePS513757.607212242IPR002885Pentatricopeptide repeat
PfamPF015350.021217239IPR002885Pentatricopeptide repeat
PROSITE profilePS513758.912243283IPR002885Pentatricopeptide repeat
PROSITE profilePS513756.16319349IPR002885Pentatricopeptide repeat
PROSITE profilePS513758.583350384IPR002885Pentatricopeptide repeat
TIGRFAMsTIGR007566.6E-4353377IPR002885Pentatricopeptide repeat
PfamPF015356.9E-4353377IPR002885Pentatricopeptide repeat
Gene3DG3DSA:1.25.40.101.7E-8353384IPR011990Tetratricopeptide-like helical domain
PROSITE profilePS513755.415385419IPR002885Pentatricopeptide repeat
PROSITE profilePS5137510.512451485IPR002885Pentatricopeptide repeat
Gene3DG3DSA:1.25.40.101.7E-8452482IPR011990Tetratricopeptide-like helical domain
TIGRFAMsTIGR007560.0022453486IPR002885Pentatricopeptide repeat
PfamPF015355.9E-6453483IPR002885Pentatricopeptide repeat
PROSITE profilePS513755.777486521IPR002885Pentatricopeptide repeat
Gene3DG3DSA:1.25.40.101.7E-8552609IPR011990Tetratricopeptide-like helical domain
PROSITE profilePS513755.744554584IPR002885Pentatricopeptide repeat
PROSITE profilePS513757.487588622IPR002885Pentatricopeptide repeat
PfamPF144323.1E-7625741IPR032867DYW domain
SuperFamilySSF466898.97E-1014711527IPR009057Homeodomain-like
PfamPF159637.8E-2514731554No hitNo description
SMARTSM007177.5E-914791527IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.8E-514801522IPR009057Homeodomain-like
CDDcd001672.51E-614821522No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 1587 aa     Download sequence    Send to blast
MLRAAYRPGL FLRNNLLALY CRCGDMRHAR LLFDGMPRRD AVSWNTLIAG YSGLGSPRLA  60
LDAFRSARAS GDGVDRFTFA AALASCAREG NWRNGRVVHG LAVVSGLART AFLTNSVIDM  120
YAKCGMIDEV RLLFDRAEER DEASWNLLLS AYVRMGWPEV AVNVLVWMHR SGVKLDSFAL  180
GGILKACSEL GDSEDVRRML HGCVVKVGLD LDVFVGSAMV DMYAKNGGLE EAIKVFDCIP  240
NQNVVVYNAM IAGFARLGND PCPEIRIEAV MLFSNMLKKR IKPSKFTFKS VLEVCNLTNA  300
VRCGRQIHAH VILSGLQADE FIASVLINLY SKARSVNDSL RCFDMTLKED VFIWTSMITA  360
FVQNEHFEKA LYLFRELLYT RKETDQFTIS SVMSACAALS VPTTCKQIHC HAVKTGLDQF  420
TVSGNSQIAM YRNIGDLKAS KLIFEQISCL DTFSWSAMIL SYAVHGYESK ALELFEKMKN  480
LGVMMNEIAS LAVLIACSHQ GLADEGLRYY ENTIPDDGFS LDVKLKACMV DLLGRVGKLA  540
DAEDFIMSSG SENDPILWHA LLRACRVHGD KERCTKIGEK LMELEPFSAS SYVMLYNLYM  600
DAGKISLAMR TRGLMRERGI TNEAGISWTD FGGSIHNFID GDNSCSHNTI HTTLEELLVR  660
VKQKTEHGGT NIWELEFQSR KLSESSISRH GELLAVAFGL TTLPSVAPVR VMKNQRISWE  720
SHETLKLLSE GENREITRRS PSAHTILQGI VASRAGEGRG SSSGHIAMID DEADFGNITD  780
ATEGQAAAKF RPKARAKPRK TSLPSRSLAP HPTVESTDEN VETLNKDSTS HEQSVDKKAA  840
SLGCHGNEAD GNACASGGIL DTPSEDVVTV SLGLVNNPDV ALDSSTVFAS VHKVSQNEEN  900
NDDLSHVATH KESMVVSDTQ APPTCCSAKT IDDLADFEGL CDDTHVEEER VAKFQPKFRV  960
KTSKAASKSQ RTNQKAGVST VDVVSQNKED GKDQAGCNDK QLHSPTRHQE SVQISYSQAH  1020
LGTHNTTIDD VANSDSIMEE LAQEEMAAKF QPRLRPKAGG ASPGVAETID AACVATPEFG  1080
VSSADVVSQD TEEDSHREGL SDGSCQKYID EEAITTSGTG PPQDLDATVD LDSHAEMVNP  1140
HPDGSPLIIG EPSAETTVKF QPYVRRKKGK GKSVSFVPPN VSHAHTPTDT NSETSNSSHF  1200
CKDIATGESL SNLPQQASEK ICISGEHHPD DQECNDPENQ YHEGEPYDHV IEQEPERDVR  1260
ETGTPMILRN RGKLQKDGIP EHTADDIMDE DFGEPPSDEQ DNDSGDEYTA RGKQKGRRKS  1320
REKNINKEPS RGTKRTSGDS TIEESQKQKL QKNKSKTSSR GQKKTSKDSS VEQPEKKLTH  1380
RIRRKRMEEV KTLLETPDHE IDRMKLSVTH LRLLQEAKER IKGKEIPSGP SSSNHSTSQF  1440
GDMDDEYNEQ DNWDNDRTEN HVVENTTKLN YHSYMNRQTR AKWSKSETDK FYEGLQQFGS  1500
DFAMIQHLFP DKSRNQVRQK FKAEEKKHPM QVHDAIMHRS RDNLYFKEVI KKLNIEDVQP  1560
DINNTHEQEG TSNEEDPGNK VCFEASV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5i9f_A7e-23155411448pentatricopeptide repeat protein dPPR-U10
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0968560.0AC096856.7 Oryza sativa chromosome 3 BAC OSJNBa0075M12 genomic sequence, complete sequence.
GenBankAP0149590.0AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015633004.10.0PREDICTED: uncharacterized protein LOC9267825
TrEMBLI1PH760.0I1PH76_ORYGL; Uncharacterized protein
STRINGORGLA03G0372200.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25952946
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39160.25e-35MYB_related family protein